PROMAN Skilled Trades
Staffing & Recruiting |
Team Size
38 professionals
Location
Dallas, Texas, United States
Specializations
Commercial and Industrial Construction Trades
About Agency
Overview
- PROMAN Skilled Trades operates exclusively in recruiting and retaining skilled tradespeople for commercial and industrial construction
- Leverages over 50 years of combined industry experience in staffing and recruitment
- Maintains operational headquarters at 1805 Royal Lane, Dallas, Texas, 75229
- Functions with a team of 38 employees focused on trades staffing
- Operates as part of the Proman Skilled Trades family of companies with dedicated project resources
Specializations
- Recruitment of carpenters for commercial and industrial construction projects
- Placement of plumbing professionals in construction settings
- Staffing of electricians for industrial construction needs
- Provision of HVAC technicians for commercial building projects
- Placement of pipefitters and welders in construction environments
Services & Approach
- Exclusive recruitment of tradesmen/women for commercial construction
- Retention programs for skilled trades professionals in industrial sectors
- Staffing solutions for carpentry positions in construction projects
- Placement services for electrical and plumbing trades in commercial builds
Contact Information
Full Address
1805 Royal Lane, Dallas, Texas, United States, 75229
Phone
‘+1 817-577-6051
Keywords
staffingtradesconstructioncarpentryplumbingelectricityhvacpipefittingwelding
Reviews (from Google)
C J
24 Mar 2023
if you apply for a job here, they email you and the email bounces back that it isn’t valid. Some woman with the last name Ramos sounds like she’s scamming. Hire an IT person to fix your domain name in your emails
Erick Noe Saavedra
01 Sep 2022
It’s a great place to work for,
Personal really efficient, ( Elizabeth, Shaun and Rafael), great people, highly recommended.
Alan Cubillos
14 Feb 2025
Horrible. Just plain horrible.
